November 1, 2025 Issue, Page 11 of 12

Page Text

The Elk City News NEWS SATURDAY, NOVEMBER 1, 2025 • 11 MERRITT Honorees and attorneys Honorable Michelle Roper HONORED McGinn to take cases, and they both answered the calling. After “There’s no country like this. We’re the longest living republic in thank you. We are all blessed to be part of this remarkable experiment Continued from page 1 Blevins reminisced about their ca- the history of mankind, and it’s be- called America, and so as your Chief reer together and Willsie’s accom- cause of our Constitution. I want to Justice, I’m honored to pin you with to speak about his colleague and plishments as a lawyer, he invited say to you, Leon, and to our lawyers your 50-Year pin and to congratu- fellow lawyer’s career. Blevins and Willsie to speak. and our judges, those of us that are late you on a distinguished career as Willsie met in 1961 when they were It was said that the seasoned at- on the front lines in these rooms a member of our bar,” Rowe said as taking piano lessons from the same torney was a man of few words, but and through these men and women he pinned Willsie. teacher, then after both went to law he spoke about his wife, Catherine, are where our rights are protected. Blevins invited everyone to a school, they returned to Western and thanked everyone for attending This is where our Constitution plays reception at the Urban House in Oklahoma to practice their craft. the ceremony. Judge Rowe stepped out every day, and it has survived Sayre to congratulate Willsie. The Willsie said that he knew he up to recognize all of the members this long because men and women reception was sponsored by Blevins wanted to become an attorney of the Oklahoma Bar who were devote their lives to taking an oath and Whinery, celebrating Willsie’s when he served on a jury. Blevins present and then presented Willsie to practice in a courtroom and up- distinguished career in Western joked about being called by Judge with his 50-year pin. hold those rights. To all of you, I say Oklahoma. Editorial: The True Value of Beef Consumers across Oklahoma by accident. Oklahoma’s ranchers flects its true value. are sincerely grateful. Your contin- have noticed that beef prices are have faced some of the tough- Behind every steak, roast, and ued trust and purchase of beef fu- higher today than they’ve been est years in memory. Persistent burger is a rancher who rises be- els rural economies and keeps our in quite some time. But while the drought, soaring input costs, and fore daylight, cares for their cat- state’s proud cattle heritage alive. dollar amount on the grocery increasing layers of government tle, and manages their land with So, as you fire up the grill, sit receipt may be larger, the story regulation have created enormous pride and responsibility. Their down at your favorite restaurant or behind that number deserves a pressure on those who raise cattle. commitment ensures that when gather around a robust pot of chili, closer look. When compared to Yet through it all, our ranching you choose beef, you’re support- know this — every bite of beef the average hourly wage, beef to- families have not only persevered ing local families and a way of life represents quality, dedication, and day costs about the same as it did — they’ve improved. Advances in deeply rooted in stewardship and the enduring partnership between decades ago. In other words, beef genetics, animal care, and grazing hard work. Oklahoma’s consumers and cattle has held its value remarkably well management have led to beef that Oklahomans continue to show producers. — delivering high-quality, nu- is more flavorful, consistent, and their appreciation through strong Ford Drummond, President, tritious protein at a fair price for sustainably produced than ever demand for beef, both at grocery Oklahoma Cattlemen’s Associa- hardworking families. before. Considering all that, it is stores and restaurants across our tion. That stability doesn’t happen fair that the price of beef today re- state. For that, Oklahoma ranchers Save the Date, Get Tickets Early By Sheryl Ponce City Honor Choir singing with the orchestra for an added flare for the Once again, the Elk City Arts evening. Seats can be reserved for Council is bringing in Christmas $60 in the lower section of the Kelli with the Oklahoma City Philhar- O’Hara Performing Arts Center and monic on Dec. 17th. The theme, $50 for the upper seats. “Merry and Bright Songs of Christ- The Arts Council is currently seek- mas,” is all about coming home for ing corporate sponsors, which comes the holidays, and enjoying the sights with choice seating. To help spon- and sounds of the season. sor this holiday event, contact Basil The program is full of holiday Weatherly at 580-821-2795. Watch favorites with Maestro Alexander Elk City Arts Council Facebook page. Mickelthwate and OKCPHIL. There To purchase tickets or for more infor- will be special guests from the Elk mation, go to elkcityartscouncil.org. REAL ESTATE AUCTION! SATURDAY, NOVEMBER 8, 2025 • 10:00 AM Owner: Catherine L. Potter Revocable Trust PROPERTY LOCATION: 210 Grove Ave., Elk City, OK OPEN HOUSE: Sunday, November 2, 2025 – 2:00-5:00 Or By Appointment We proudly support the students, staff and administration at Merritt Schools Great Plains Bank ~ First National Bank Legal Description: Lot 6 & South 28’ of Lot 7 in the Rev. Block 1 of the Walter Addition to the City of Elk City, Beckham County, OK. Surface Rights Only. Yes Finance Property Description: This beautiful brick home offers a comfortable and spacious living environment, featuring three bedrooms, two and a half bathrooms. With approximately 1,978 square feet of living area, it is designed to accommodate family living with both style and functionality. The kitchen is well equipped with a built-in oven, Jenn-Air electric cooktop, trash compactor, and dishwasher. Adjacent to the kitchen is a Keeping Room, which includes a dining area and a built-in desk, providing a welcoming space for meals and casual gatherings. Upon entering the home, you are greeted by a spacious living room. This area features a wet bar, and a dual sided ¿UHSODFHÀDQNHGE\ERRNFDVHVFXULRFDELQHWVDQGWYFDELQHWDQGDGGLWLRQDOGLQLQJDUHDFUHDWLQJDQLQYLWLQJ 1414 W. 3rd St., Elk City, OK DWPRVSKHUHIRUUHOD[DWLRQDQGHQWHUWDLQLQJ7KHODUJHPDVWHUVXLWHLQFOXGHVD¿UHSODFHIRUDGGHGFRPIRUW7KHIXOO bathroom boasts a sauna, jet jacuzzi tub, separate shower, double lavatories, and a large walk-in closet. A door 580.225.1525 from the master suite provides direct access to the back patio. The utility room is equipped with a half bath and a pull-out pantry and a fold down ironing board for added convenience. The double car garage features a cedar LocalLoanGroup.com closet, shop area, and abundant storage. This home has an inviting back yard with a 20’x22’ covered patio, perfect for outdoor gatherings, beautiful landscape, mature trees, and a putting green. Additional features include a 8’ x 10’ safe room, storage building, two HVAC units, two water heaters, Culligan water softener, a central vacuum system, a Rainbird sprinkler system for both front and back yards. Flooring throughout the home consist of both carpet and wood, offering comfort and style. Looking for that perfect home….Don’t miss this opportunity!!! SUBSCRIBE TODAY Real Estate Terms: 10% of purchase price to be placed in escrow day of sale. Purchaser’s attorney will have 10 days to examine title. Balance of purchase price to be due and payable upon acceptance of title. All 2024 and prior taxes will be paid by the seller. 2025 taxes will be pro-rated to day of closing. All property is sold “as is where is”. $XFWLRQLVQRWFRQWLQJHQWXSRQEX\HUVHFXULQJRUREWDLQLQJ¿QDQFLQJ Grant’s Auction & Realty Current news and 580-225-0269 • “The Complete Liquidation Professionals” great deals delivered Mike Grant Auctioneer/Sales Associate Texas License #13353 Cindy Grant Cashier/Real Estate Broker Elk City, OK FIND US ON THE WEB AT www.grantsauction.com Brandon Cloud Auctioneer Monte Tucker Auctioneer & Sales Associate Sunny Point, America Mobile: 821-1186 Mobile: 821-1738 Johnny Grant 1926-2010 (580) 515-4477 right to your door! ANY ANNOUNCEMENTS MADE DAY OF SALE SUPERSEDE ALL PREVIOUS WRITTEN OR ORAL STATEMENTS.